Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD40/TNFRSF5 (4D11) Monoclonal Antibody

  • ARO-A15804-50
  • Validated ELISA

Original price was: €367.00.Current price is: €274.00.

50ug 25% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD40/TNFRSF5 (4D11) Monoclonal Antibody

Product name ARO-A15804-100
Uniprot ID P25942
Uniprot link P25942
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, TNFRSF5, CDw40, CD40
Reference ARO-A15804
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD40/TNFRSF5 (4D11)
Clone Name 4D11
Protein Name CD40/TNFRSF5 (4D11)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15804-1MG
Uniprot ID P25942
Uniprot link P25942
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, TNFRSF5, CDw40, CD40
Reference ARO-A15804
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD40/TNFRSF5 (4D11)
Clone Name 4D11
Protein Name CD40/TNFRSF5 (4D11)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15804-50
Uniprot ID P25942
Uniprot link P25942
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, TNFRSF5, CDw40, CD40
Reference ARO-A15804
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD40/TNFRSF5 (4D11)
Clone Name 4D11
Protein Name CD40/TNFRSF5 (4D11)
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD40/TNFRSF5 (4D11) Monoclonal Antibody

SEC-HPLC of Human CD40/TNFRSF5 (4D11) Monoclonal Antibody

Human CD40/TNFRSF5 (4D11) Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD40/TNFRSF5 (4D11) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD40/TNFRSF5 (4D11) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products