Brand: ProteoGenix

Human CD354-TREM1 recombinant protein

PX-P6227
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: Q9NP99
Molecular weight:: 23.72 kDa

€379.00

100ug + 379 loyalty points

Met1–Arg200 His

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Human CD354-TREM1 recombinant protein

Product name	Human CD354-TREM1 recombinant protein
Uniprot ID	Q9NP99
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Raw Antigen Sequence	MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR
Molecular weight	23.72 kDa
Protein delivered with Tag?	C-Terminal His Tag
Purity estimated	>85% by SDS-PAGE
Buffer	0.01M PBS, pH 7.4.
Delivery condition	Dry Ice
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Met1-Arg200
Aliases /Synonyms	TREM1, Triggering receptor expressed on monocytes 1, Triggering receptor expressed on myeloid cells 1, TREM-1, CD354
Reference	PX-P6227
Note	For research use only
Molecular Constructor	Met1–Arg200 His