Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD335/NCR1/NKp46 Monoclonal Antibody

  • ARO-A15881-50
  • Validated ELISA

Original price was: €286.00.Current price is: €231.00.

50ug 19% OFF + 231 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SEC-HPLC of Human CD335/NCR1/NKp46 Monoclonal Antibody
Human CD335/NCR1/NKp46 Monoclonal Antibody

Human CD335/NCR1/NKp46 Monoclonal Antibody

Product name ARO-A15881-100
Uniprot ID O76036
Uniprot link O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A15881
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD335/NCR1/NKp46
Clone Name NKp46-1
Protein Name CD335/NCR1/NKp46
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15881-1MG
Uniprot ID O76036
Uniprot link O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A15881
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD335/NCR1/NKp46
Clone Name NKp46-1
Protein Name CD335/NCR1/NKp46
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15881-50
Uniprot ID O76036
Uniprot link O76036
Raw Antigen Sequence MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVQFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms LY94, Natural cytotoxicity triggering receptor 1, Natural killer cell p46-related protein, NK cell-activating receptor, NK-p46, CD335, NKp46, NCR1, hNKp46, Lymphocyte antigen 94 homolog
Reference ARO-A15881
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD335/NCR1/NKp46
Clone Name NKp46-1
Protein Name CD335/NCR1/NKp46
Target species Anti-Human Monoclonal Antibody

SEC-HPLC of Human CD335/NCR1/NKp46 Monoclonal Antibody

SEC-HPLC of Human CD335/NCR1/NKp46 Monoclonal Antibody

Human CD335/NCR1/NKp46 Monoclonal Antibodywas analyzed by size exclusion chromatography with UV detection.

Human CD335/NCR1/NKp46 Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD335/NCR1/NKp46 Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products