Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD264-TNFRSF10D recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9UBN6
Molecular weight:
49.10 kDa

€209.00

100ug + 209 loyalty points
Met1–His211 Fc
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD264-TNFRSF10D recombinant protein

Product name Human CD264-TNFRSF10D recombinant protein
Uniprot ID Q9UBN6
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MGLWGQSVPTASSARAGRYPGARTASGTRPWLLDPKILKFVVFIVAVLLPVRVDSATIPRQDEVPQQTVAPQQQRRSLKEEECPAGSHRSEYTGACNPCTEGVDYTIASNNLPSCLLCTVCKSGQTNKSSCTTTRDTVCQCEKGSFQDKNSPEMCRTCRTGCPRGMVKVSNCTPRSDIKCKNESAASSTGKTPAAEETVTTILGMLASPYH
Molecular weight 49.10 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer 0.01M PBS, pH 7.4.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-His211
Aliases /Synonyms TRAIL-R4, TRAIL receptor 4, DcR2, TRAIL receptor with a truncated death domain, TRUNDD, DCR2, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TRAILR4, TNFRSF10D, Tumor necrosis factor receptor superfamily member 10D, CD264
Reference PX-P6230
Note For research use only
Molecular Constructor
Met1–His211 Fc

SDS-PAGE for Human CD264-TNFRSF10D recombinant protein

SDS-PAGE for Human CD264-TNFRSF10D recombinant protein

Human CD264-TNFRSF10D recombinant protein, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD264-TNFRSF10D recombinant protein

There are no reviews yet.

Be the first to review “Human CD264-TNFRSF10D recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products