Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CD24 (3B6) Monoclonal Antibody

Original price was: €332.00.Current price is: €274.00.

50ug 17% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CD24 (3B6) Monoclonal Antibody

Product name ARO-A15986-100
Uniprot ID P25063
Uniprot link P25063
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Signal transducer CD24, CD24, CD24A, Small cell lung carcinoma cluster 4 antigen
Reference ARO-A15986
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD24 (3B6)
Clone Name 3B6
Protein Name CD24 (3B6)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15986-1MG
Uniprot ID P25063
Uniprot link P25063
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Signal transducer CD24, CD24, CD24A, Small cell lung carcinoma cluster 4 antigen
Reference ARO-A15986
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD24 (3B6)
Clone Name 3B6
Protein Name CD24 (3B6)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15986-50
Uniprot ID P25063
Uniprot link P25063
Raw Antigen Sequence MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms Signal transducer CD24, CD24, CD24A, Small cell lung carcinoma cluster 4 antigen
Reference ARO-A15986
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD24 (3B6)
Clone Name 3B6
Protein Name CD24 (3B6)
Target species Anti-Human Monoclonal Antibody

Human CD24 (3B6) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD24 (3B6) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products