Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD23/FCER2 (P5E8) Monoclonal Antibody

  • ARO-A15971-50
  • Validated ELISA

Original price was: €323.00.Current price is: €231.00.

50ug 28% OFF + 231 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human CD23/FCER2 (P5E8) Monoclonal Antibody binds to Human CD23/FCER2 Recombinant Protein, N-His in ELISA Assay
Human CD23/FCER2 (P5E8) Monoclonal Antibody

Human CD23/FCER2 (P5E8) Monoclonal Antibody

Product name ARO-A15971-100
Uniprot ID P06734
Uniprot link P06734
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-A15971
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD23/FCER2 (P5E8)
Clone Name P5E8
Protein Name CD23/FCER2 (P5E8)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15971-1MG
Uniprot ID P06734
Uniprot link P06734
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-A15971
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD23/FCER2 (P5E8)
Clone Name P5E8
Protein Name CD23/FCER2 (P5E8)
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15971-50
Uniprot ID P06734
Uniprot link P06734
Raw Antigen Sequence MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Human
Aliases /Synonyms Lymphocyte IgE receptor, C-type lectin domain family 4 member J, Low affinity immunoglobulin epsilon Fc receptor, CD23A, BLAST-2, Immunoglobulin E-binding factor, IGEBF, CD23, Fc-epsilon-RII, CLEC4J, FCE2, FCER2
Reference ARO-A15971
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD23/FCER2 (P5E8)
Clone Name P5E8
Protein Name CD23/FCER2 (P5E8)
Target species Anti-Human Monoclonal Antibody

Human CD23/FCER2 (P5E8) Monoclonal Antibody binds to Human CD23/FCER2 Recombinant Protein, N-His in ELISA Assay

Human CD23/FCER2 (P5E8) Monoclonal Antibody binds to Human CD23/FCER2 Recombinant Protein, N-His in ELISA Assay

Human CD23/FCER2 Recombinant Protein, N-His(cat. No.ARO-P17793) at 0.5µg/mL (100µL/well) can bind Human CD23/FCER2 (P5E8) Monoclonal Antibody in indirect ELISA with Goat secondary antibody measured by OD450.

Human CD23/FCER2 (P5E8) Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD23/FCER2 (P5E8) Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products