Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human CALCR/Calcitonin receptor/CT-R Recombinant Protein, C-Fc

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P30988
Molecular weight:
43.68 kDa

Original price was: €285.00.Current price is: €228.00.

50ug 20% OFF + 228 loyalty points
Ala25–Ile153 Fc
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human CALCR/Calcitonin receptor/CT-R Recombinant Protein, C-Fc

Product name ARO-P19235-100
Uniprot ID P30988
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAI
Molecular weight 43.68 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ile153
Aliases /Synonyms CALCR, CT-R, Calcitonin receptor
Reference ARO-P19235
Note For research use only.
Molecular Constructor
Ala25–Ile153 Fc
Product name ARO-P19235-1MG
Uniprot ID P30988
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAI
Molecular weight 43.68 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ile153
Aliases /Synonyms CALCR, CT-R, Calcitonin receptor
Reference ARO-P19235
Note For research use only.
Molecular Constructor
Ala25–Ile153 Fc
Product name ARO-P19235-50
Uniprot ID P30988
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDDTPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKNAYVLYYLAI
Molecular weight 43.68 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 1 mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ala25-Ile153
Aliases /Synonyms CALCR, CT-R, Calcitonin receptor
Reference ARO-P19235
Note For research use only.
Molecular Constructor
Ala25–Ile153 Fc

There are no reviews yet.

Be the first to review “Human CALCR/Calcitonin receptor/CT-R Recombinant Protein, C-Fc”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products