Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human C4orf48 recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q5BLP8
Molecular weight:
34.53 kDa

Original price was: €212.00.Current price is: €193.00.

50ug 9% OFF + 193 loyalty points
Fc Glu35–His95
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Human C4orf48 recombinant protein

Human C4orf48 recombinant protein

Product name PX-P6544-100
Uniprot ID Q5BLP8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Molecular weight 34.53 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu35-His95
Aliases /Synonyms C4orf48Neuropeptide-like protein C4orf48,
Reference PX-P6544
Molecular Constructor
Fc Glu35–His95
Product name PX-P6544-1MG
Uniprot ID Q5BLP8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Molecular weight 34.53 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu35-His95
Aliases /Synonyms C4orf48Neuropeptide-like protein C4orf48,
Reference PX-P6544
Molecular Constructor
Fc Glu35–His95
Product name PX-P6544-50
Uniprot ID Q5BLP8
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence EPAGSAVPAQSRPCVDCHAFEFMQRALQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Molecular weight 34.53 kDa
Protein delivered with Tag? N-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu35-His95
Aliases /Synonyms C4orf48Neuropeptide-like protein C4orf48,
Reference PX-P6544
Molecular Constructor
Fc Glu35–His95

There are no reviews yet.

Be the first to review “Human C4orf48 recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products