Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human BNP peptide-Natriuretic peptides B
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human BNP peptide-Natriuretic peptides B |
|---|---|
| Uniprot ID | P16860 |
| Uniprot link | http://www.uniprot.org/uniprot/P16860 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MGSHHHHHHSGHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
| Molecular weight | 28.85kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 85% |
| Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Aliases /Synonyms | NT-PROBNP, BNP, Natriuretic peptide B, GC-B, B-Type Natriuretic Peptide, Ventricular Natriuretic Peptide, Gamma-brain natriuretic peptide, Brain natriuretic peptide 32 |
| Reference | PX-P4047 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.