Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human ANGPT2-Ang2 recombinant protein

  • PX-P6245
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
O15123
Molecular weight:
83.24 kDa

420.00

100ug + 420 loyalty points
Tyr19–Phe496 Fc
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Human ANGPT2-Ang2 recombinant protein

Product name Human ANGPT2-Ang2 recombinant protein
Uniprot ID O15123
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular weight 83.24 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Purity estimated >85% by SDS-PAGE
Buffer Lyophilized from a solution in PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Tyr19-Phe496
Aliases /Synonyms Angiopoietin-2, ANG-2, ANGPT2
Reference PX-P6245
Note For research use only
Molecular Constructor
Tyr19–Phe496 Fc

Human ANGPT2-Ang2 recombinant protein binds to Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb in indirect ELISA Assay

Human ANGPT2-Ang2 recombinant protein binds to Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Faricimab Biosimilar - Anti-ANGPT2, VEGFA mAb (cat. No.PX-TA1501) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 66.43M.

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb binds to Human ANGPT2 in indirect ELISA Assay

Immobilized Human ANGPT2-Ang2 recombinant protein (cat. No.PX-P6245) at 0.5µg/mL (100µL/well) can bind Vanucizumab Biosimilar - Anti-ANGPT2, VEGFA, mAb (cat. No.PX-TA1355) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.6M.

Human ANGPT2-Ang2 recombinant protein

There are no reviews yet.

Be the first to review “Human ANGPT2-Ang2 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products