Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Growth/differentiation factor 11(GDF11)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O95390
Molecular weight:
13.7kDa

€182.00

50ug + 182 loyalty points
His Asn299–Ser407
size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Growth/differentiation factor 11(GDF11)

Growth/differentiation factor 11(GDF11)

Product name Growth/differentiation factor 11(GDF11)
Uniprot ID O95390
Uniprot link https://www.uniprot.org/uniprot/O95390
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAG PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Molecular weight 13.7kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn299-Ser407
Protein Accession O95390
Spec:Entrez GeneID 10220
Spec:NCBI Gene Aliases VHO; BMP11; BMP-11
NCBI Reference O95390
Aliases /Synonyms Bone morphogenetic protein 11,Bone morphogenetic protein 11,BMP-11,BMP11
Reference PX-P4823
Note For research use only
Molecular Constructor
His Asn299–Ser407
Product name Growth/differentiation factor 11(GDF11)
Uniprot ID O95390
Uniprot link https://www.uniprot.org/uniprot/O95390
Expression system Prokaryotic expression
Sequence MGSHHHHHHSGNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAG PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Molecular weight 13.7kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn299-Ser407
Protein Accession O95390
Spec:Entrez GeneID 10220
Spec:NCBI Gene Aliases VHO; BMP11; BMP-11
NCBI Reference O95390
Aliases /Synonyms Bone morphogenetic protein 11,Bone morphogenetic protein 11,BMP-11,BMP11
Reference PX-P4823
Note For research use only
Molecular Constructor
His Asn299–Ser407

There are no reviews yet.

Be the first to review “Growth/differentiation factor 11(GDF11)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products