Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

FLT3LG protein(FLT3LG)

Host species:
Insect
Origin species:
Homo sapiens (Human)
Uniprot ID:
B7ZLY4

210.00

50ug + 210 loyalty points
His Ser25–Pro184
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

FLT3LG protein(FLT3LG)

Product name FLT3LG protein(FLT3LG)
Uniprot ID B7ZLY4
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence SGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser25-Pro184
Aliases /Synonyms FLT3LG protein, FLT3LG
Reference PX-P4689
Note For research use only
Molecular Constructor
His Ser25–Pro184
Product name FLT3LG protein(FLT3LG)
Uniprot ID B7ZLY4
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence SGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Insect
Fragment Type Ser25-Pro184
Aliases /Synonyms FLT3LG protein, FLT3LG
Reference PX-P4689
Note For research use only
Molecular Constructor
His Ser25–Pro184

FLT3LG protein(FLT3LG)

There are no reviews yet.

Be the first to review “FLT3LG protein(FLT3LG)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products