Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fibroblast growth factor 1(FGF1) (16-155)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
P05230
Molecular weight:
17kDa

Original price was: €273.00.Current price is: €210.00.

50ug 23% OFF + 210 loyalty points
Phe16~Asp155 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Fibroblast growth factor 1(FGF1) (16-155)

Product name Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID P05230
Uniprot link https://www.uniprot.org/uniprot/P05230
Expression system Prokaryotic expression
Raw Antigen Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight 17kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe16~Asp155
Protein Accession P05230
Spec:Entrez GeneID 2246
Spec:NCBI Gene Aliases AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID Q16588
NCBI Reference P05230
Aliases /Synonyms FGFA,aFGF,ECGF,HBGF-1
Reference PX-P4884
Note For research use only
Molecular Constructor
Phe16~Asp155 His
Product name Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID P05230
Uniprot link https://www.uniprot.org/uniprot/P05230
Expression system Prokaryotic expression
Raw Antigen Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight 17kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe16~Asp155
Protein Accession P05230
Spec:Entrez GeneID 2246
Spec:NCBI Gene Aliases AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID Q16588
NCBI Reference P05230
Aliases /Synonyms FGFA,aFGF,ECGF,HBGF-1
Reference PX-P4884
Note For research use only
Molecular Constructor
Phe16~Asp155 His
Product name PX-P4884-1MG
Uniprot ID P05230
Uniprot link https://www.uniprot.org/uniprot/P05230
Expression system Prokaryotic expression
Raw Antigen Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight 17kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Phe16~Asp155
Protein Accession P05230
Spec:Entrez GeneID 2246
Spec:NCBI Gene Aliases AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID Q16588
NCBI Reference P05230
Aliases /Synonyms FGFA,aFGF,ECGF,HBGF-1
Reference PX-P4884
Note For research use only
Molecular Constructor
Phe16~Asp155 His

Fibroblast growth factor 1(FGF1) (16-155)

There are no reviews yet.

Be the first to review “Fibroblast growth factor 1(FGF1) (16-155)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products