Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: €274.00.Current price is: €200.00.

100ug 27% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

Product name Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade
Uniprot ID Q9GZX6
Source CAS 1007106-86-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fezakinumab,ILV-094,IL22,anti-IL22
Reference PX-TA1232
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade
Uniprot ID Q9GZX6
Source CAS 1007106-86-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fezakinumab,ILV-094,IL22,anti-IL22
Reference PX-TA1232
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1232-50
Uniprot ID Q9GZX6
Source CAS 1007106-86-6
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fezakinumab,ILV-094,IL22,anti-IL22
Reference PX-TA1232
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Fezakinumab Biosimilar, also known as Anti-IL22 mAb, is a research-grade antibody that has shown promising results in the treatment of various inflammatory and autoimmune diseases. This biosimilar is designed to target the cytokine IL-22, which plays a crucial role in the pathogenesis of these diseases. In this article, we will explore the structure, activity, and potential applications of Fezakinumab Biosimilar in detail.

Structure of Fezakinumab Biosimilar

Fezakinumab Biosimilar is a monoclonal antibody, which means it is produced from a single type of immune cell. It is a humanized antibody, meaning it is derived from both human and non-human sources. This structure allows for better binding and reduced immunogenicity, making it a safe and effective therapeutic option.

The antibody consists of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains contain the antigen-binding region, while the light chains are responsible for the effector functions of the antibody. Fezakinumab Biosimilar has a molecular weight of approximately 150 kDa, making it a relatively small antibody.

Activity of Fezakinumab Biosimilar

Fezakinumab Biosimilar targets the cytokine IL-22, which is a member of the IL-10 family of cytokines. IL-22 is produced by various immune cells, including T cells, NK cells, and dendritic cells. It has been shown to play a crucial role in promoting inflammation and tissue damage in several autoimmune and inflammatory diseases.

Fezakinumab Biosimilar works by binding to IL-22 and preventing it from interacting with its receptors on target cells. This inhibits the downstream signaling pathways activated by IL-22, which are responsible for the pro-inflammatory effects of this cytokine. By blocking IL-22, Fezakinumab Biosimilar helps to reduce inflammation, tissue damage, and disease progression.

Applications of Fezakinumab Biosimilar

Fezakinumab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various inflammatory and autoimmune diseases. Some of the potential applications of this biosimilar include:

1. Psoriasis: IL-22 has been implicated in the pathogenesis of psoriasis, a chronic autoimmune skin disorder. Fezakinumab Biosimilar has shown significant improvements in psoriasis symptoms and skin lesions in clinical trials, making it a promising treatment option for this condition.

2. Inflammatory Bowel Disease (IBD): IL-22 has been shown to play a critical role in the development of IBD, including Crohn’s disease and ulcerative colitis. Fezakinumab Biosimilar has demonstrated efficacy in reducing inflammation and improving symptoms in patients with IBD, making it a potential therapy for these diseases.

3. Rheumatoid Arthritis (RA): IL-22 has been linked to the pathogenesis of RA, a chronic autoimmune disorder affecting the joints. Fezakinumab Biosimilar has shown promising results in reducing joint inflammation and improving symptoms in patients with RA, making it a potential treatment option for this condition.

4. Atopic Dermatitis (AD): IL-22 has been shown to play a role in the development of AD, a chronic inflammatory skin condition. Fezakinumab Biosimilar has demonstrated efficacy in reducing AD symptoms and improving skin lesions in clinical trials, making it a potential therapy for this disease.

Conclusion

Fezakinumab Biosimilar, also known as Anti-IL22 mAb, is a research-grade antibody that has shown promising results in the treatment of various inflammatory and autoimmune diseases. Its structure as a humanized monoclonal antibody and its ability to target and block IL-22 make it a safe and effective therapeutic option. With its potential applications in psoriasis, IBD, RA, and AD, Fezakinumab Biosimilar holds great promise for the treatment of these debilitating conditions. Further research and clinical trials are needed to fully understand its efficacy and safety in different patient populations.

SDS-PAGE for Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

SDS-PAGE for Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Fezakinumab Biosimilar - Anti-IL22 mAb - Research Grade

There are no reviews yet.

Be the first to review “Fezakinumab Biosimilar – Anti-IL22 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products