Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
C5MKY7&Q08431
Molecular weight:
27kDa&28kDa

Original price was: €237.00.Current price is: €210.00.

50ug 11% OFF + 210 loyalty points
Met1–Lys239 & Trp137-Cys387 His
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

Product name Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)
Uniprot ID C5MKY7&Q08431
Uniprot link https://www.uniprot.org/uniprot/Q08431
Expression system Prokaryotic expression
Raw Antigen Sequence MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH
Molecular weight 27kDa&28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239 & Trp137-Cys387
Protein Accession AGT36556 & Q08431
Spec:Entrez GeneID 4240
Spec:NCBI Gene Aliases BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Reference AGT36556 & Q08431
Aliases /Synonyms Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1
Reference PX-P4698
Note For research use only
Molecular Constructor
Met1–Lys239 & Trp137-Cys387 His
Product name Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)
Uniprot ID C5MKY7&Q08431
Uniprot link https://www.uniprot.org/uniprot/Q08431
Expression system Prokaryotic expression
Raw Antigen Sequence MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH
Molecular weight 27kDa&28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239 & Trp137-Cys387
Protein Accession AGT36556 & Q08431
Spec:Entrez GeneID 4240
Spec:NCBI Gene Aliases BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Reference AGT36556 & Q08431
Aliases /Synonyms Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1
Reference PX-P4698
Note For research use only
Molecular Constructor
Met1–Lys239 & Trp137-Cys387 His
Product name PX-P4698-1MG
Uniprot ID C5MKY7&Q08431
Uniprot link https://www.uniprot.org/uniprot/Q08431
Expression system Prokaryotic expression
Raw Antigen Sequence MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH
Molecular weight 27kDa&28kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Lys239 & Trp137-Cys387
Protein Accession AGT36556 & Q08431
Spec:Entrez GeneID 4240
Spec:NCBI Gene Aliases BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Reference AGT36556 & Q08431
Aliases /Synonyms Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1
Reference PX-P4698
Note For research use only
Molecular Constructor
Met1–Lys239 & Trp137-Cys387 His

Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)

There are no reviews yet.

Be the first to review “Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products