Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Enhanced green fluorescent protein(egfp)&Lactadherin (MFGE8) |
|---|---|
| Uniprot ID | C5MKY7&Q08431 |
| Uniprot link | https://www.uniprot.org/uniprot/Q08431 |
| Expression system | Prokaryotic expression |
| Sequence | MGMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGGGSGGGGWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCLEHHHHHH |
| Molecular weight | 27kDa&28kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Lys239 & Trp137-Cys387 |
| Protein Accession | AGT36556 & Q08431 |
| Spec:Entrez GeneID | 4240 |
| Spec:NCBI Gene Aliases | BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888 |
| NCBI Reference | AGT36556 & Q08431 |
| Aliases /Synonyms | Breast epithelial antigen BA46,HMFG,MFGM,Milk fat globule-EGF factor 8,MFG-E8,SED1 |
| Reference | PX-P4698 |
| Note | For research use only |
Related products
Biosimilar
Sontuzumab Biosimilar – Anti-MUC1, CD227 mAb – Research Grade
PX-TA1179 200€Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.