Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Edrecolomab ELISA Kit

1,179.00

96T + 1179 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Edrecolomab ELISA Kit

Edrecolomab ELISA Kit

Product name Edrecolomab ELISA Kit
Uniprot ID P16422
Raw Antigen Sequence MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX198
Note For research use only.
Sample type Plasma, Serum
Target Edrecolomab
Immunogen Edrecolomab

Introduction

The Edrecolomab ELISA Kit is a highly sensitive and specific diagnostic tool used for the detection of the Edrecolomab antibody in various biological samples. This kit is designed to provide accurate and reliable results for the quantification of Edrecolomab, a promising therapeutic target for various diseases. In this article, we will discuss the structure, activity, and application of the Edrecolomab ELISA Kit in detail.

Structure of Edrecolomab ELISA Kit

The Edrecolomab ELISA Kit is composed of several components including microtiter plates, enzyme-labeled Edrecolomab, and detection reagents. The microtiter plates are coated with a specific antibody that binds to the Edrecolomab present in the sample. The enzyme-labeled Edrecolomab is then added to the plate, which binds to the captured Edrecolomab. Finally, the detection reagents are added, which produce a colorimetric signal that is directly proportional to the amount of Edrecolomab present in the sample.

Activity of Edrecolomab ELISA Kit

The Edrecolomab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay (ELISA), which is a highly sensitive and specific technique for the detection and quantification of specific antibodies. The microtiter plate is coated with a specific antibody that captures the Edrecolomab present in the sample. The enzyme-labeled Edrecolomab then binds to the captured Edrecolomab, forming a sandwich complex. The detection reagents then produce a colorimetric signal, which is measured using a spectrophotometer. The intensity of the color is directly proportional to the amount of Edrecolomab present in the sample, allowing for accurate quantification.

Application of Edrecolomab ELISA Kit

The Edrecolomab ELISA Kit has a wide range of applications in both research and clinical settings. It is primarily used for the detection and quantification of Edrecolomab in various biological samples such as serum, plasma, and cell culture supernatants. This kit can be used for the diagnosis of various diseases, as Edrecolomab is a promising therapeutic target for several conditions including cancer, autoimmune diseases, and infectious diseases.

In cancer research, the Edrecolomab ELISA Kit is used to monitor the levels of Edrecolomab in patients undergoing treatment with anti- cancer drugs. It can also be used to study the mechanism of action of Edrecolomab and its role in tumor growth and progression. In clinical settings, this kit can aid in the diagnosis and monitoring of cancer patients, as well as in the development of personalized treatment plans.

In autoimmune diseases, the Edrecolomab ELISA Kit can be used to detect and quantify autoantibodies against Edrecolomab. This can aid in the early diagnosis and management of diseases such as rheumatoid arthritis and systemic lupus erythematosus. In infectious diseases, this kit can be used to detect the presence of Edrecolomab in patients infected with specific pathogens, providing valuable information for disease diagnosis and treatment.

Conclusion

The Edrecolomab ELISA Kit is a highly sensitive and specific diagnostic tool for the detection and quantification of Edrecolomab, a promising therapeutic target for various diseases. Its simple and reliable design makes it a valuable tool for both research and clinical applications. With its wide range of applications, this kit has the potential to advance our understanding and treatment of various diseases, making it an essential tool for scientists and clinicians alike.

Edrecolomab ELISA Kit

There are no reviews yet.

Be the first to review “Edrecolomab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products