Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €260.00.Current price is: €200.00.

100ug 23% OFF + 200 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

Product name Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40
Reference PX-TA2056
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40
Reference PX-TA2056
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2056-50
Uniprot ID P25942
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNFRSF5, Tumor necrosis factor receptor superfamily member 5, B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CD40
Reference PX-TA2056
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade is a novel biosimilar antibody that has shown promising results in targeting TNFRSF5, a therapeutic target for various diseases. This biosimilar is a monoclonal antibody (mAb) that has been developed as a cost-effective alternative to the original anti-TNFRSF5 mAbs. In this article, we will discuss the structure, activity, and potential applications of Dalnicastobart Biosimilar in detail.

Structure of Dalnicastobart Biosimilar

Dalnicastobart Biosimilar is a recombinant mAb that has been developed using advanced genetic engineering techniques. It is a chimeric antibody, meaning it contains both human and non-human components. The variable region of the antibody is derived from the original anti-TNFRSF5 mAb, while the constant region is humanized to reduce the risk of immunogenicity. This structure allows Dalnicastobart Biosimilar to specifically target TNFRSF5 without causing any adverse immune reactions.

Activity of Dalnicastobart Biosimilar

Dalnicastobart Biosimilar exerts its activity by binding to TNFRSF5, also known as CD40, on the surface of cells. TNFRSF5 is a type I transmembrane protein that is expressed on various immune cells, including B cells, T cells, and dendritic cells. It plays a crucial role in regulating immune responses and is involved in the development of autoimmune diseases, allergies, and certain cancers.

By binding to TNFRSF5, Dalnicastobart Biosimilar blocks its interaction with its ligand, CD154. This interaction is essential for the activation and differentiation of B cells and T cells, which are key players in immune responses. By inhibiting this interaction, Dalnicastobart Biosimilar suppresses the immune response, leading to a reduction in inflammation and tissue damage.

Applications of Dalnicastobart Biosimilar

Dalnicastobart Biosimilar has shown promising results in preclinical studies for the treatment of various diseases. Some potential applications of this biosimilar include:

1. Autoimmune Diseases: TNFRSF5 has been implicated in the development of autoimmune diseases such as rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. By targeting TNFRSF5, Dalnicastobart Biosimilar can potentially alleviate the symptoms of these diseases and improve the quality of life for patients.

2. Allergies: TNFRSF5 has also been linked to the development of allergies, including allergic asthma and allergic rhinitis. By blocking TNFRSF5, Dalnicastobart Biosimilar can potentially reduce the severity of allergic reactions and improve the overall health of patients.

3.

Cancer: TNFRSF5 is overexpressed on the surface of certain

cancer cells and is involved in promoting their growth and survival. By inhibiting TNFRSF5, Dalnicastobart Biosimilar can potentially inhibit tumor growth and enhance the efficacy of other cancer treatments.

4.

Transplant Rejection: TNFRSF5 is involved in the activation of immune cells that can lead to transplant rejection. By targeting TNFRSF5, Dalnicastobart Biosimilar can potentially prevent transplant rejection and improve the success rate of organ transplants.

Conclusion

In conclusion, Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade is a novel biosimilar antibody that has shown promising results in targeting TNFRSF5, a therapeutic target for various diseases. Its unique structure and mechanism of action make it a potential treatment option for autoimmune diseases, allergies, cancer, and transplant rejection. Further clinical studies are needed to fully evaluate the efficacy and safety of this biosimilar in various disease conditions.

SDS-PAGE for Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

SDS-PAGE for Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Dalnicastobart Biosimilar - Anti-TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Dalnicastobart Biosimilar – Anti-TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products