Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CXCL9 / MIG, N-His, recombinant protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q07325
Molecular weight:
14.02 kDa

€329.00

100ug + 329 loyalty points
His Thr23–Thr125
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

CXCL9 / MIG, N-His, recombinant protein

Product name CXCL9 / MIG, N-His, recombinant protein
Uniprot ID Q07325
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Molecular weight 14.02 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr23-Thr125
Protein Accession Q07325
Reference PX-P5681
Note For research use only
Molecular Constructor
His Thr23–Thr125

CXCL9 / MIG, N-His, recombinant protein

There are no reviews yet.

Be the first to review “CXCL9 / MIG, N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products