Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cow SAA3 Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Cow
Uniprot ID:
Q8SQ28
Molecular weight:
14,19 kDa

210.00

50ug + 210 loyalty points
Partial Yes
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Cow SAA3 Recombinant Protein

Product name Cow SAA3 Recombinant Protein
Uniprot ID Q8SQ28
Uniprot link http://www.uniprot.org/uniprot/Q8SQ28
Origin species Cow
Expression system Prokaryotic expression
Sequence MRGSHHHHHHGSQRWGTFLKEAGQGAKDMWRAYQDMKEANYRGADKYFHARGNYDAARRGPGGAWAAKVISNARETIQGI TDPLFKGMTRDQVREDSKADQFANEWGRSGKDPNHFRPAGLPDKY
Molecular weight 14,19 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_851359.2
Spec:Entrez GeneID 281474
Spec:SwissProtID Q8SQ28
NCBI Reference NP_851359.2
Aliases /Synonyms SAA3, serum amyloid A 3 precursor
Reference PX-P2056
Note For research use only
Molecular Constructor
Partial Yes
Product name Cow SAA3 Recombinant Protein
Uniprot ID Q8SQ28
Uniprot link http://www.uniprot.org/uniprot/Q8SQ28
Origin species Cow
Expression system Procaryotic expression
Sequence MRGSHHHHHHGSQRWGTFLKEAGQGAKDMWRAYQDMKEANYRGADKYFHARGNYDAARRGPGGAWAAKVISNARETIQGI TDPLFKGMTRDQVREDSKADQFANEWGRSGKDPNHFRPAGLPDKY
Molecular weight 14,19 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_851359.2
Spec:Entrez GeneID 281474
Spec:SwissProtID Q8SQ28
NCBI Reference NP_851359.2
Aliases /Synonyms SAA3, serum amyloid A 3 precursor
Reference PX-P2056
Note For research use only
Molecular Constructor
Partial Yes
Product name Cow SAA3 Recombinant Protein
Uniprot ID Q8SQ28
Uniprot link http://www.uniprot.org/uniprot/Q8SQ28
Origin species Cow
Expression system Prokaryotic expression
Sequence MRGSHHHHHHGSQRWGTFLKEAGQGAKDMWRAYQDMKEANYRGADKYFHARGNYDAARRGPGGAWAAKVISNARETIQGI TDPLFKGMTRDQVREDSKADQFANEWGRSGKDPNHFRPAGLPDKY
Molecular weight 14,19 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, imidazole 400mM, pH7.4
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession NP_851359.2
Spec:Entrez GeneID 281474
Spec:SwissProtID Q8SQ28
NCBI Reference NP_851359.2
Aliases /Synonyms SAA3, serum amyloid A 3 precursor
Reference PX-P2056
Note For research use only
Molecular Constructor
Partial Yes

About the Cow SAA3 Protein

The Serum Amyloid A3 (SAA3) is a SAA isoform expressed in colostrum and milk of Bos Taurus (usual cows in Europe) and secreted in particular from uterine cervix cells and mammary gland. The SAA3 protein is a high-density lipoprotein particle (HDL).This type of proteins are usually product in the liver. SAA3 is an acute phase protein (APP) which is participating in the innate immune response. Serum Amyloid A are expressed in high concentrations during inflammation causing by viral or bacterial infections. These high expressions can be measured as a veterinarian diagnosis tool to identify intra-mammal infections in cows, as the level of SAA3 increases during inflammation processes. It is also expressed in variable levels during lactation period.

Functions of SAA3 protein

Several immunological functions of the SAA3 protein have been identified, such as opsonisation of bacteria, activation of metalloproteinase expression in immune cells, chemotaxis of immune cells, such as leukocytes, and cytokine modulation. In general, SAA3 protein is protecting organism as an anti-inflammatory factor.

Which research area?

The Cow SAA3 recombinant protein could be used for experiences of immunomodulation. Proteogenix offers this Cow SAA3 recombinant protein expressed in prokaryotic system to improve knowledge about immunity and inflammation mechanisms.

SDS-PAGE For Cow SAA3 Recombinant Protein

SDS-PAGE For Cow SAA3 Recombinant Protein

Cow SAA3 Recombinant Protein, on SDS-PAGE under non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.

There are no reviews yet.

Be the first to review “Cow SAA3 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products