Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Cow SAA3 Recombinant Protein |
|---|---|
| Uniprot ID | Q8SQ28 |
| Uniprot link | http://www.uniprot.org/uniprot/Q8SQ28 |
| Origin species | Cow |
| Expression system | Prokaryotic expression |
| Sequence | MRGSHHHHHHGSQRWGTFLKEAGQGAKDMWRAYQDMKEANYRGADKYFHARGNYDAARRGPGGAWAAKVISNARETIQGI TDPLFKGMTRDQVREDSKADQFANEWGRSGKDPNHFRPAGLPDKY |
| Molecular weight | 14,19 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, imidazole 400mM, pH7.4 |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | NP_851359.2 |
| Spec:Entrez GeneID | 281474 |
| Spec:SwissProtID | Q8SQ28 |
| NCBI Reference | NP_851359.2 |
| Aliases /Synonyms | SAA3, serum amyloid A 3 precursor |
| Reference | PX-P2056 |
| Note | For research use only |
The Serum Amyloid A3 (SAA3) is a SAA isoform expressed in colostrum and milk of Bos Taurus (usual cows in Europe) and secreted in particular from uterine cervix cells and mammary gland. The SAA3 protein is a high-density lipoprotein particle (HDL).This type of proteins are usually product in the liver. SAA3 is an acute phase protein (APP) which is participating in the innate immune response. Serum Amyloid A are expressed in high concentrations during inflammation causing by viral or bacterial infections. These high expressions can be measured as a veterinarian diagnosis tool to identify intra-mammal infections in cows, as the level of SAA3 increases during inflammation processes. It is also expressed in variable levels during lactation period.
Several immunological functions of the SAA3 protein have been identified, such as opsonisation of bacteria, activation of metalloproteinase expression in immune cells, chemotaxis of immune cells, such as leukocytes, and cytokine modulation. In general, SAA3 protein is protecting organism as an anti-inflammatory factor.
The Cow SAA3 recombinant protein could be used for experiences of immunomodulation. Proteogenix offers this Cow SAA3 recombinant protein expressed in prokaryotic system to improve knowledge about immunity and inflammation mechanisms.
Cow SAA3 Recombinant Protein, on SDS-PAGE under non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.