Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Chromosomal replication initiator protein DnaA

Host species:
Escherichia coli (E.coli)
Uniprot ID:
D7HH42
Molecular weight:
54.43kDa

210.00

50ug + 210 loyalty points
Mer1-472Ser
size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Chromosomal replication initiator protein DnaA

Product name Chromosomal replication initiator protein DnaA
Uniprot ID D7HH42
Uniprot link http://www.uniprot.org/uniprot/D7HH42
Expression system Prokaryotic expression
Sequence MGLSEGIVSSSLWLQCLQRLQEELPAAEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNNINRLLMEFSGNDVPN LRFEVGSRPVVAPKPAPVRTAADVAAESSAPAQLAQRKPIHKTWDDDSAAADITHRSNVNPKHKFNNFVEGKSNQLGLAA ARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALL IDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDH QIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVAD LLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSSGSHHHH HH
Molecular weight 54.43kDa
Purity estimated >40% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl/PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Mer1-472Ser
Aliases /Synonyms /
Reference PX-P4506
Note For research use only
Molecular Constructor
Mer1-472Ser
Product name Chromosomal replication initiator protein DnaA
Uniprot ID D7HH42
Uniprot link http://www.uniprot.org/uniprot/D7HH42
Expression system Prokaryotic expression
Sequence MGLSEGIVSSSLWLQCLQRLQEELPAAEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNNINRLLMEFSGNDVPN LRFEVGSRPVVAPKPAPVRTAADVAAESSAPAQLAQRKPIHKTWDDDSAAADITHRSNVNPKHKFNNFVEGKSNQLGLAA ARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALL IDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDH QIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVAD LLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSSGSHHHH HH
Molecular weight 54.43kDa
Purity estimated >40% by SDS-PAGE
Buffer 50 mM Tris-HCl pH 8.0, 150 mM NaCl/PBS pH 7.5, 4 M urea
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Mer1-472Ser
Aliases /Synonyms /
Reference PX-P4506
Note For research use only
Molecular Constructor
Mer1-472Ser

General Information about Chromosomal replication initiator protein DnaA

This entry represents the central domain of bacterial DnaA protein, which plays an important role in initiating and regulating chromosome replication. DnaA is an ATP and DNA binding protein. It specifically binds to a 9 bp nucleotide repeat sequence, the dnaA box, which is found in the chromosomal origin of replication (oriC). DnaA is a protein of about 50kDa and contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP binding domain, and the second is located in the C-terminal half and may be involved in DNA binding. The protein can also bind RNA polymerase β subunit, dnaB and dnaZ proteins, and groE gene products (chaperone proteins).

There are no reviews yet.

Be the first to review “Chromosomal replication initiator protein DnaA”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products