Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now
  • Wide range of unique reagents
  • Free Shipping
    Free shipping in EU on Orders > €500
  • Fast worldwide delivery
    Fast worldwide delivery

Chromosomal replication initiator protein DnaA

Reference:
size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameChromosomal replication initiator protein DnaA
Uniprot IDD7HH42
Uniprot linkhttp://www.uniprot.org/uniprot/D7HH42
Expression systemProkaryotic expression
SequenceMGLSEGIVSSSLWLQCLQRLQEELPAAEFSMWVRPLQAELNDNTLTLFAPNRFVLDWVRDKYLNNINRLLMEFSGNDVPN LRFEVGSRPVVAPKPAPVRTAADVAAESSAPAQLAQRKPIHKTWDDDSAAADITHRSNVNPKHKFNNFVEGKSNQLGLAA ARQVSDNPGAAYNPLFLYGGTGLGKTHLLHAVGNAIVDNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALL IDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEISGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKAEDH QIHLPDEVAFFIAKRLRSNVRELEGALNRVIANANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVAD LLSKRRSRSVARPRQLAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDYSNLIRTLSSGSHHHH HH
Molecular weight54.43kDa
Purity estimated>40% by SDS-PAGE
Buffer50 mM Tris-HCl pH 8.0, 150 mM NaCl/PBS pH 7.5, 4 M urea
Delivery conditionDry Ice
Delivery lead time in business daysEurope: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypeMer1-472Ser
Aliases /Synonyms/
ReferencePX-P4506
NoteFor research use only

Description of Chromosomal replication initiator protein DnaA

General Information about Chromosomal replication initiator protein DnaA

This entry represents the central domain of bacterial DnaA protein, which plays an important role in initiating and regulating chromosome replication. DnaA is an ATP and DNA binding protein. It specifically binds to a 9 bp nucleotide repeat sequence, the dnaA box, which is found in the chromosomal origin of replication (oriC). DnaA is a protein of about 50kDa and contains two conserved regions: the first is located in the N-terminal half and corresponds to the ATP binding domain, and the second is located in the C-terminal half and may be involved in DNA binding. The protein can also bind RNA polymerase β subunit, dnaB and dnaZ proteins, and groE gene products (chaperone proteins).

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Chromosomal replication initiator protein DnaA”

Your email address will not be published. Required fields are marked *

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

    Cart (0 Items)

    Your cart is currently empty.

    View Products