Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | CD91 Recombinant Protein |
|---|---|
| Uniprot ID | Q07954 |
| Uniprot link | http://www.uniprot.org/uniprot/Q07954 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
| Molecular weight | 37kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ala20~Gly292 |
| Aliases /Synonyms | A2MR,APR |
| Reference | PX-P4094 |
| Note | For research use only |
The 1 receptor of the related 1-lipoprotein protein (LRP1), also known as alpha-2-macroglobulin receptor (A2MR), apolipoprotein E receptor (APOER) or differentiation cluster 91 (CD91), is a Protein forming a receptor, which is present in cells and participate in receptor-mediated endocytosis. In humans, the LRP1 protein is encoded by the LRP1 gene. LRP1 is also a key signaling protein and is therefore involved in several biological processes, such as lipoprotein metabolism and cell movement, as well as neurodegenerative diseases, atherosclerosis and cancer.
CD91 Recombinant Protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.