Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD80 Recombinant Protein |
|---|---|
| Uniprot ID | P33681 |
| Uniprot link | http://www.uniprot.org/uniprot/P33681 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN |
| Molecular weight | 45kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1~Asn242 |
| Aliases /Synonyms | CD28LG, CD28LG1, LAB7 |
| Reference | PX-P4090 |
| Note | For research use only |
Cluster of Differentiation 80, also known as B7-1, is a member of the cell surface immunoglobulin superfamily. It is expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. CD80 plays a fundamental but different role in the activation of T cells. B7-1 / CD80 and B7-2 / CD86 and its CD28 and CTLA4 receptors constitute one of the main co-stimulatory pathways that regulate the response of T and B cells. CD80 is mainly expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. Although CTLA-4 and CD28 can bind to the same ligand, CTLA-4 binds B7-1 and B7-2 with an affinity 20-100 times greater than CD28 and participates in the negative regulation of immune responses. Therefore, CD80 is considered a promising therapeutic target for autoimmune diseases and various types of cancer.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.