Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD80 Recombinant Protein |
---|---|
Uniprot ID | P33681 |
Uniprot link | http://www.uniprot.org/uniprot/P33681 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDN |
Molecular weight | 45kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1~Asn242 |
Aliases /Synonyms | CD28LG, CD28LG1, LAB7 |
Reference | PX-P4090 |
Note | For research use only |
Cluster of Differentiation 80, also known as B7-1, is a member of the cell surface immunoglobulin superfamily. It is expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. CD80 plays a fundamental but different role in the activation of T cells. B7-1 / CD80 and B7-2 / CD86 and its CD28 and CTLA4 receptors constitute one of the main co-stimulatory pathways that regulate the response of T and B cells. CD80 is mainly expressed on the surface of antigen presenting cells, including activated B cells, macrophages and dendritic cells. Although CTLA-4 and CD28 can bind to the same ligand, CTLA-4 binds B7-1 and B7-2 with an affinity 20-100 times greater than CD28 and participates in the negative regulation of immune responses. Therefore, CD80 is considered a promising therapeutic target for autoimmune diseases and various types of cancer.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.