Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD52 Recombinant Protein |
|---|---|
| Uniprot ID | P31358 |
| Uniprot link | http://www.uniprot.org/uniprot/P31358 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPS |
| Molecular weight | 40kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Ser36 |
| Aliases /Synonyms | CDW52, HE5 |
| Reference | PX-P4084 |
| Note | For research use only |
CD52 / CDW52 are small glycosyl phosphatidylinositol (GPI) anchor glycoproteins. It has a mature peptide containing only 12 amino acids and is expressed in large numbers on human lymphocytes. From a clinical point of view, this protein is an important target for therapeutic intervention for leukopenia in haematological neoplasms and post transplant immunosuppression. CD52 / CDW52 may play a role in carbohydrate transport and targeting. It is an excellent target for complement mediated cell lysis.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.