Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD52 Recombinant Protein |
|---|---|
| Uniprot ID | P31358 |
| Uniprot link | http://www.uniprot.org/uniprot/P31358 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPS |
| Molecular weight | 40kDa |
| Protein delivered with Tag? | C-terminal Fc Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Ser36 |
| Aliases /Synonyms | CDW52, HE5 |
| Reference | PX-P4084 |
| Note | For research use only |
CD52 / CDW52 are small glycosyl phosphatidylinositol (GPI) anchor glycoproteins. It has a mature peptide containing only 12 amino acids and is expressed in large numbers on human lymphocytes. From a clinical point of view, this protein is an important target for therapeutic intervention for leukopenia in haematological neoplasms and post transplant immunosuppression. CD52 / CDW52 may play a role in carbohydrate transport and targeting. It is an excellent target for complement mediated cell lysis.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.