Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | CD317 Recombinant Protein |
|---|---|
| Uniprot ID | Q10589 |
| Uniprot link | http://www.uniprot.org/uniprot/Q10589 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS |
| Molecular weight | 39.49kDa |
| Protein delivered with Tag? | N-terminal Gst Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser50~Ser161 |
| Aliases /Synonyms | / |
| Reference | PX-P4118 |
| Note | For research use only |
Tetherin, also known as bone marrow antigen 2, is a lip-associated protein and is encoded by the BST2 gene in humans. Furthermore, Tetherin was named CD317 (differentiated aggregate 317). The protein is structurally expressed in mature B cells, plasma cells, and plasma dendritic cells. In many other cells, it is expressed only in response to stimulation of the IFN pathway.
Tetherin is a human cell protein that prevents retroviral infection by preventing the spread of virus particles after budding from infected cells. Tetherin was originally found to act as an inhibitor of HIV-1 infection without lack of Vpu, but it has also been shown to inhibit the release of other RNA viruses (such as Lassa and Marburg virgin), indicating a form of prevent the release of encapsulated viruses without interacting with males. The common mechanism of protein interaction. Furthermore, Tetherin also limits the neural invasion of the HSV-1 DNA virus.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.