Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | CD317 Recombinant Protein |
|---|---|
| Uniprot ID | Q10589 |
| Uniprot link | http://www.uniprot.org/uniprot/Q10589 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | SEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS |
| Molecular weight | 39.49kDa |
| Protein delivered with Tag? | N-terminal Gst Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ser50~Ser161 |
| Aliases /Synonyms | / |
| Reference | PX-P4118 |
| Note | For research use only |
Tetherin, also known as bone marrow antigen 2, is a lip-associated protein and is encoded by the BST2 gene in humans. Furthermore, Tetherin was named CD317 (differentiated aggregate 317). The protein is structurally expressed in mature B cells, plasma cells, and plasma dendritic cells. In many other cells, it is expressed only in response to stimulation of the IFN pathway.
Tetherin is a human cell protein that prevents retroviral infection by preventing the spread of virus particles after budding from infected cells. Tetherin was originally found to act as an inhibitor of HIV-1 infection without lack of Vpu, but it has also been shown to inhibit the release of other RNA viruses (such as Lassa and Marburg virgin), indicating a form of prevent the release of encapsulated viruses without interacting with males. The common mechanism of protein interaction. Furthermore, Tetherin also limits the neural invasion of the HSV-1 DNA virus.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.