Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein

Host species:
Mammalian cells
Origin species:
Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Uniprot ID:
AAP97490.1
Molecular weight:
41.01 kDa

Original price was: €349.00.Current price is: €277.00.

50ug 21% OFF + 277 loyalty points
Ser20–Tyr137 Fc
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein

Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein

Product name PX-P6460-100
Uniprot ID AAP97490.1
Origin species Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Expression system Eukaryotic expression
Raw Antigen Sequence SSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNY
Molecular weight 41.01 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser20-Tyr137
Aliases /Synonyms GTHIILH beta subunit,
Reference PX-P6460
Molecular Constructor
Ser20–Tyr137 Fc
Product name PX-P6460-1MG
Uniprot ID AAP97490.1
Origin species Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Expression system Eukaryotic expression
Raw Antigen Sequence SSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNY
Molecular weight 41.01 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser20-Tyr137
Aliases /Synonyms GTHIILH beta subunit,
Reference PX-P6460
Molecular Constructor
Ser20–Tyr137 Fc
Product name PX-P6460-50
Uniprot ID AAP97490.1
Origin species Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon)
Expression system Eukaryotic expression
Raw Antigen Sequence SSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNY
Molecular weight 41.01 kDa
Protein delivered with Tag? C-Terminal Fc Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Ser20-Tyr137
Aliases /Synonyms GTHIILH beta subunit,
Reference PX-P6460
Molecular Constructor
Ser20–Tyr137 Fc

Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein

There are no reviews yet.

Be the first to review “Acipenser gueldenstaedtii (Russian sturgeon) (Danube sturgeon) Russian sturgeon GTHII/LHB recombinant protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products