Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD132 Recombinant Protein |
---|---|
Uniprot ID | P31785 |
Uniprot link | http://www.uniprot.org/uniprot/P31785 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
Molecular weight | 30.70kDa |
Protein delivered with Tag? | C-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Met1-Asn254 |
Aliases /Synonyms | IL2RG |
Reference | PX-P4105 |
Note | For research use only |
The common gamma chain (γc) (or CD132), also known as the interleukin 2 receptor γ or IL2RG subunit, is a member of the type I cytokine family and is expressed in most lymphocytes (leukocytes) and its cells in mammals. A gene was found on its X chromosome. The common γ (γc) chain (or IL2RG) is the cytokine receptor subunit, which is the cytokine receptor subunit shared by the receptor complexes of at least six different interleukin receptors. IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin 21 receptors. It is a component of many cytokine receptors, which are essential for the development and function of lymphocytes. Severe X-linked combined immunodeficiency (XSCID) is a rare and life-threatening disease caused by mutations in IL2RG (the gene that encodes IL2RG). Based on chemical binding data, IL2RG has been shown to be a component of the IL-4 receptor, that is, the ability of IL2RG to increase IL-4 binding affinity. The observation that the IL-2R range is a functional part of the IL-4 receptor, and the discovery that IL-2Rγ is related to the IL-7 receptor, began to explain why the lack of this γ chain common (γc) has an impact on lymphatic development and function. It has a profound impact, as seen in X-linked severe combined immunodeficiency.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.