Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | CD132 Recombinant Protein |
|---|---|
| Uniprot ID | P31785 |
| Uniprot link | http://www.uniprot.org/uniprot/P31785 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN |
| Molecular weight | 30.70kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH7.5 |
| Delivery condition | Dry Ice |
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Met1-Asn254 |
| Aliases /Synonyms | IL2RG |
| Reference | PX-P4105 |
| Note | For research use only |
The common gamma chain (γc) (or CD132), also known as the interleukin 2 receptor γ or IL2RG subunit, is a member of the type I cytokine family and is expressed in most lymphocytes (leukocytes) and its cells in mammals. A gene was found on its X chromosome. The common γ (γc) chain (or IL2RG) is the cytokine receptor subunit, which is the cytokine receptor subunit shared by the receptor complexes of at least six different interleukin receptors. IL-2, IL-4, IL-7, IL-9, IL-15 and interleukin 21 receptors. It is a component of many cytokine receptors, which are essential for the development and function of lymphocytes. Severe X-linked combined immunodeficiency (XSCID) is a rare and life-threatening disease caused by mutations in IL2RG (the gene that encodes IL2RG). Based on chemical binding data, IL2RG has been shown to be a component of the IL-4 receptor, that is, the ability of IL2RG to increase IL-4 binding affinity. The observation that the IL-2R range is a functional part of the IL-4 receptor, and the discovery that IL-2Rγ is related to the IL-7 receptor, began to explain why the lack of this γ chain common (γc) has an impact on lymphatic development and function. It has a profound impact, as seen in X-linked severe combined immunodeficiency.
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.