Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human CD132/IL2RG Monoclonal Antibody

Original price was: €409.00.Current price is: €330.00.

100ug 19% OFF + 330 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Human CD132/IL2RG Monoclonal Antibody
Human CD132/IL2RG Monoclonal Antibody

Human CD132/IL2RG Monoclonal Antibody

Product name ARO-A16056-100
Uniprot ID P31785 & P24394
Uniprot link P31785
Raw Antigen Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms p64, Interleukin-2 receptor subunit gamma, gammaC, IL-2 receptor subunit gamma, CD132, IL-2R subunit gamma, IL-2RG, IL2RG, Cytokine receptor common subunit gamma
Reference ARO-A16056
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD132/IL2RG
Clone Name A2
Protein Name CD132/IL2RG
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16056-1MG
Uniprot ID P31785 & P24394
Uniprot link P31785
Raw Antigen Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms p64, Interleukin-2 receptor subunit gamma, gammaC, IL-2 receptor subunit gamma, CD132, IL-2R subunit gamma, IL-2RG, IL2RG, Cytokine receptor common subunit gamma
Reference ARO-A16056
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD132/IL2RG
Clone Name A2
Protein Name CD132/IL2RG
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16056-50
Uniprot ID P31785 & P24394
Uniprot link P31785
Raw Antigen Sequence MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Form Liquid in PBS buffer, pH 7.4
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Aliases /Synonyms p64, Interleukin-2 receptor subunit gamma, gammaC, IL-2 receptor subunit gamma, CD132, IL-2R subunit gamma, IL-2RG, IL2RG, Cytokine receptor common subunit gamma
Reference ARO-A16056
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD132/IL2RG
Clone Name A2
Protein Name CD132/IL2RG
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Human CD132/IL2RG Monoclonal Antibody

SDS-PAGE for Human CD132/IL2RG Monoclonal Antibody

Human CD132/IL2RG Monoclonal Antibody, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Human CD132/IL2RG Monoclonal Antibody

There are no reviews yet.

Be the first to review “Human CD132/IL2RG Monoclonal Antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products