Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Canakinumab Biosimilar – Anti-IL1B mAb – Research Grade

  • PX-TA1176-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: €185.00.Current price is: €140.00.

50ug 24% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Product name Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 914613-48-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Canakinumab,ACZ885,IL1B,anti-IL1B
Reference PX-TA1176
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade
Uniprot ID P01584
Source CAS 914613-48-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Canakinumab,ACZ885,IL1B,anti-IL1B
Reference PX-TA1176
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1176-50
Uniprot ID P01584
Source CAS 914613-48-2
Species Homo sapiens
Expression system Mammalian cells
Raw Antigen Sequence MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Molecular weight 145kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Canakinumab,ACZ885,IL1B,anti-IL1B
Reference PX-TA1176
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Canakinumab Biosimilar, also known as Anti-IL1B mAb, is a monoclonal antibody that targets the inflammatory cytokine interleukin-1 beta (IL-1β). This biosimilar is a research grade version of Canakinumab, a FDA-approved therapeutic antibody used for the treatment of various inflammatory diseases. In this article, we will discuss the structure, activity, and potential applications of Canakinumab Biosimilar as a therapeutic antibody.

Structure of Canakinumab Biosimilar

Canakinumab Biosimilar is a fully human IgG1 monoclonal antibody that is produced through recombinant DNA technology. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The antibody has a typical Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab region is responsible for binding to IL-1β, while the Fc region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

Canakinumab Biosimilar works by specifically binding to IL-1β and inhibiting its activity. IL-1β is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various inflammatory diseases. By binding to IL-1β, Canakinumab Biosimilar prevents it from interacting with its receptors, thereby blocking its downstream signaling pathways. This leads to a decrease in the production of other pro-inflammatory cytokines and chemokines, ultimately reducing inflammation and associated symptoms.

Potential Applications

Canakinumab Biosimilar has shown promising results in pre-clinical studies for the treatment of various inflammatory diseases. It has been shown to be effective in reducing inflammation and symptoms in conditions such as rheumatoid arthritis, gout, and familial Mediterranean fever. In addition, Canakinumab Biosimilar has also been investigated as a potential treatment for cardiovascular diseases, as IL-1β has been implicated in the development of atherosclerosis and heart disease.

Anti-inflammatory Effects

One of the main applications of Canakinumab Biosimilar is in the treatment of inflammatory diseases. In a phase III clinical trial, Canakinumab was shown to be effective in reducing the frequency of gout flares in patients with gout. It has also been studied in patients with rheumatoid arthritis, where it was found to improve symptoms and inhibit joint damage. These results suggest that Canakinumab Biosimilar may be a promising therapeutic option for various inflammatory conditions.

Cardiovascular Disease

Canakinumab Biosimilar has also been investigated for its potential in reducing the risk of cardiovascular events. In a large-scale clinical trial, Canakinumab was shown to significantly reduce the risk of recurrent cardiovascular events in patients with a history of heart attack. This effect was independent of its anti-inflammatory properties, suggesting that Canakinumab may have additional cardioprotective mechanisms.

Future Directions

As a research grade version of Canakinumab, Canakinumab Biosimilar has the potential to be used in various pre-clinical studies to further understand the role of IL-1β in different diseases. It can also be used as a comparator in clinical trials to evaluate the efficacy and safety of new therapeutic antibodies targeting IL-1β. In addition, the development of Canakinumab Biosimilar may also lead to a more affordable and accessible treatment option for patients with inflammatory diseases.

Conclusion

Canakinumab Biosimilar, a research grade version of Canakinumab, is a promising therapeutic antibody targeting IL-1β. Its specific binding and inhibitory effects on IL-1β make it a potential treatment option for various inflammatory diseases and cardiovascular conditions

IL1B / IL1F2, C-His, recombinant protein binds to Canakinumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

IL1B / IL1F2, C-His, recombinant protein binds to Canakinumab Biosimilar - Anti-IL1B mAb in indirect ELISA assay

Immobilized IL1B / IL1F2, C-His, recombinant protein (cat. No.PX-P5783) at 0.5µg/mL (100µL/well) can bind Canakinumab Biosimilar - Anti-IL1B mAb (cat. No.PX-TA1176) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 1182M.

SDS-PAGE for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

SDS-PAGE for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Flow Cytometry results for Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

Flow-cytometry using PE anti-human IL1B antibody. 5637 cells were fixed and permeabilized, then stained with an irrelevant antibody (Blue Histogram) or an PE anti-human IL1B monoclonal antibody (Catalog PX-TA1176, Yellow Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, cells analysed on a NovoCyte Flow Cytometer.

Canakinumab Biosimilar - Anti-IL1B mAb - Research Grade

There are no reviews yet.

Be the first to review “Canakinumab Biosimilar – Anti-IL1B mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products