Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | c-JUN Protein - Transcription factor AP-1(JUN) |
|---|---|
| Uniprot ID | P05412 |
| Uniprot link | https://www.uniprot.org/uniprot/P05412 |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
| Molecular weight | 37.78kDa |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | 0.02% Sarcosyl, PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Phe331 |
| Aliases /Synonyms | Activator protein 1,Proto-oncogene c-Jun,V-jun avian sarcoma virus 17 oncogene homolog,p39 |
| Reference | PX-P4739 |
| Note | For research use only |
C-Jun protein is coded by the JUN gene in humans. This protein, together with c-Fos protein forms the AP-1 transcription factor. Because of its interaction with c-Fos protein, c-Jun protein was initially identified as a Fos-binding protein p39. C-Jun protein is involved in the progression through G1 phase. The role of c-Jun protein is to regulate the activity of cyclin D1 activity which is a Rb kinase. Rb protein is a growth suppressor and is inactivated upon phosphorylation. When c-jun protein is absent, the expression of both p53 and p21 increases which results in cell cycle defects. For this reason, c-jun knockout is lethal. However, transgenic animals that contain c-jun protein that cannot undergo phosphorylation, can survive. In this case cells remain blocked in G1 phase. Upregulation of c-jun protein results in increased cell growth and proliferation which makes c-jun a proto-oncogenic protein.
C-Jun, along with c-Fos protein are highly regulated by different extracellular stimuli such as growth factors, pro-inflammatory cytokines, UV irradiation and oxidative cellular stress. Indeed, increased UV irradiation has been linked to elevated c-jun expression. ERK pathway has also been involved in c-jun expression regulation. Active ERK increases c-jun transcription as well as its stability. The mobilization of c-jun protein leads to the activation of it downstream target RCAK1 which enhances JNK activity. JNK is a kinase that binds to c-jun and double phosphorylates the protein on Ser-63 and Ser-73 of its transcriptional activation domain. Research suggests that the phosphorylation of c-jun protein on threonine 91 and 93 triggers c-jun pro-apoptotic activity . According to Ce et al., (2013) the phosphorylation of c-Jun at threonine 91 and threonine 93 is dependent of threonine 95 which suggested the combination of the three threonines as a sensitive amplifier of the JNK cascade. On the other hand, the JNK triggered survival pathway is inhibited by a survival pathway initiate by lithium which represses pro-apoptotic c-Jun/Ap-1 target genes.
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.