Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

BHQ880 Biosimilar – Anti-DKK1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa(silence)

Original price was: €193.00.Current price is: €140.00.

50ug 27% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade

Product name BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade
Uniprot ID O94907
Species Human
Expression system XtenCHO
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference PX-TA1933
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa(silence)
Clonality Monoclonal Antibody
Product name BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade
Uniprot ID O94907
Species Human
Expression system XtenCHO
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference PX-TA1933
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa(silence)
Clonality Monoclonal Antibody
Product name PX-TA1933-50
Uniprot ID O94907
Species Human
Expression system XtenCHO
Raw Antigen Sequence MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-Dickkopf-1, SK, hDkk-1, Dkk-1, Dickkopf-related protein 1, DKK1
Reference PX-TA1933
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa(silence)
Clonality Monoclonal Antibody

Introduction to BHQ880 Biosimilar – Anti-DKK1 mAb – Research Grade

BHQ880 Biosimilar, also known as Anti-DKK1 mAb, is a monoclonal antibody that has been developed as a biosimilar to treat various diseases. This article will provide a comprehensive overview of the structure, activity, and potential applications of BHQ880 Biosimilar in the field of medicine.

Structure of BHQ880 Biosimilar

BHQ880 Biosimilar is a monoclonal antibody that specifically targets the protein Dickkopf-1 (DKK1). It is a fully humanized antibody, meaning that it is derived from human cells and has a high binding affinity for DKK1. The antibody has a molecular weight of approximately 150 kDa and is composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains contain only a variable region.

Activity of BHQ880 Biosimilar

BHQ880 Biosimilar works by binding to DKK1 and blocking its activity. DKK1 is a secreted protein that plays a crucial role in the Wnt signaling pathway, which is involved in cell proliferation, differentiation, and survival. DKK1 is overexpressed in various diseases, including cancer, osteoporosis, and rheumatoid arthritis, and has been identified as a potential therapeutic target.

By binding to DKK1, BHQ880 Biosimilar prevents it from interacting with its receptors, thus inhibiting the Wnt signaling pathway. This leads to a decrease in cell proliferation and survival, making BHQ880 Biosimilar a promising treatment for diseases that involve abnormal cell growth.

Applications of BHQ880 Biosimilar

BHQ880 Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various diseases. Some potential applications of BHQ880 Biosimilar include:

1.

Cancer: DKK1 is overexpressed in many types of cancer, including multiple myeloma, breast cancer, and lung cancer. By blocking DKK1, BHQ880 Biosimilar has the potential to inhibit tumor growth and metastasis.

2. Osteoporosis: DKK1 has been implicated in the development of osteoporosis, a condition characterized by weak and brittle bones. BHQ880 Biosimilar may be able to prevent bone loss by inhibiting DKK1 and promoting bone formation.

3. Rheumatoid arthritis: DKK1 is involved in the inflammation and destruction of joints in rheumatoid arthritis. By targeting DKK1, BHQ880 Biosimilar may be able to reduce joint damage and improve symptoms in patients with this condition.

4. Other diseases: DKK1 has also been linked to other diseases, such as Alzheimer’s disease, psoriasis, and diabetic retinopathy. BHQ880 Biosimilar may have potential applications in these conditions as well.

Conclusion

BHQ880 Biosimilar, also known as Anti-DKK1 mAb, is a promising monoclonal antibody that targets the protein DKK1. By blocking DKK1, BHQ880 Biosimilar has the potential to treat a variety of diseases, including cancer, osteoporosis, and rheumatoid arthritis. Further studies and clinical trials are needed to fully evaluate the efficacy and safety of this biosimilar, but it holds great promise as a potential therapeutic agent in the field of medicine.

SDS-PAGE for Research Grade BHQ880

SDS-PAGE for Research Grade BHQ880

Research Grade BHQ880, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

BHQ880 Biosimilar - Anti-DKK1 mAb - Research Grade

There are no reviews yet.

Be the first to review “BHQ880 Biosimilar – Anti-DKK1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products