Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Asunercept Biosimilar – Anti-CD95L fusion protein – Research Grade

Uniprot ID:
P48023

Original price was: €172.00.Current price is: €140.00.

50ug 19% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade

Product name Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade
Uniprot ID P48023
Expression system XtenCHO
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference PX-TA2001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FAS (Fas cell surface death receptor, TNFRSF6, tumor necrosis factor receptor (TNFR) superfamily member 6, FAS1, APO-1, CD95)]2 - IGHG1 Fc (Fragment constant)
Product name Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade
Uniprot ID P48023
Expression system XtenCHO
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference PX-TA2001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FAS (Fas cell surface death receptor, TNFRSF6, tumor necrosis factor receptor (TNFR) superfamily member 6, FAS1, APO-1, CD95)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2001-50
Uniprot ID P48023
Expression system XtenCHO
Raw Antigen Sequence MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-Receptor-binding FasL ectodomain, APL, APT1LG1, FasL ICD, Fas antigen ligand, CD178, sFasL, CD95L, APTL, TNFSF6, Apoptosis antigen ligand, SPA, FASLG, FasL, SPPL2A-processed FasL form, Tumor necrosis factor ligand superfamily member 6, Soluble Fas ligand, Fas ligand, CD95 ligand, CD95-L, FASL
Reference PX-TA2001
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FAS (Fas cell surface death receptor, TNFRSF6, tumor necrosis factor receptor (TNFR) superfamily member 6, FAS1, APO-1, CD95)]2 - IGHG1 Fc (Fragment constant)

Asunercept Biosimilar – Anti-CD95L fusion protein – Research Grade Introduction

Asunercept Biosimilar is a novel anti-CD95L fusion protein that has been developed as a potential therapeutic agent for various diseases. This research grade product is a biosimilar version of the original Asunercept, which has shown promising results in pre-clinical and clinical studies. In this article, we will provide a scientific description of the structure, activity, and potential applications of Asunercept Biosimilar.

Structure of Asunercept Biosimilar

Asunercept Biosimilar is a fusion protein composed of two components: the extracellular domain of human CD95 (Fas/APO-1) receptor and the Fc region of human IgG1 antibody. The CD95 domain is responsible for binding to CD95L, while the Fc region provides stability and enhances the half-life of the protein in the body. This fusion protein has a molecular weight of approximately 80 kDa and is produced using recombinant DNA technology.

Mechanism of Action

Asunercept Biosimilar works by inhibiting the activity of CD95L, a protein that is involved in cell death and inflammation. CD95L, also known as Fas ligand or Apo-1 ligand, is a member of the tumor necrosis factor (TNF) family and is expressed on the surface of various cells, including immune cells and cancer cells. When CD95L binds to its receptor, CD95, it triggers a signaling pathway that leads to cell death. By blocking this interaction, Asunercept Biosimilar can prevent excessive cell death and inflammation, which are implicated in many diseases.

Applications of Asunercept Biosimilar

Asunercept Biosimilar has shown potential as a therapeutic agent for various diseases, including autoimmune disorders, cancer, and infectious diseases. Here are some of the specific applications where Asunercept Biosimilar may be beneficial:

1.

Autoimmune Disorders

Autoimmune disorders, such as rheumatoid arthritis, multiple sclerosis, and psoriasis, are characterized by an overactive immune response. Asunercept Biosimilar can modulate the immune response by inhibiting CD95L, which is involved in the activation and death of immune cells. This could potentially reduce the symptoms and progression of autoimmune diseases.

2.

Cancer

CD95L is overexpressed in many types of cancer, and its interaction with CD95 can promote tumor growth and metastasis. Asunercept Biosimilar can block this interaction and inhibit the growth and survival of cancer cells. It may also enhance the effectiveness of other cancer treatments, such as chemotherapy and immunotherapy.

3.

Infectious Diseases

Infectious diseases, such as viral infections and sepsis, can lead to excessive cell death and inflammation. Asunercept Biosimilar can prevent this by inhibiting CD95L, which is upregulated in response to infection. It may also enhance the immune response against pathogens by modulating the activity of immune cells.

Research Grade

Asunercept Biosimilar is currently available as a research grade product, which means it is intended for use in laboratory research and not for human or animal use. It is produced under strict quality control standards to ensure purity, potency, and consistency. Researchers can use this product to study the mechanism of action, efficacy, and safety of Asunercept Biosimilar in various disease models.

Conclusion

Asunercept Biosimilar is a promising therapeutic agent that targets CD95L, a protein involved in cell death and inflammation. Its unique structure and mechanism of action make it a potential treatment option for various diseases, including autoimmune disorders, cancer, and infectious diseases. As a research grade product, it offers a valuable tool

SDS-PAGE for Research Grade Asunercept

SDS-PAGE for Research Grade Asunercept

Research Grade Asunercept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Asunercept Biosimilar - Anti-CD95L fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Asunercept Biosimilar – Anti-CD95L fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products