Cart (0 Items)
Your cart is currently empty.
View ProductsIt looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.
Switch to US ($)Original price was: €163.00.€127.00Current price is: €127.00.
50ug 22% OFF + 127 loyalty points
Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.
ARO-A11020
ARO-A11022
ARO-A11034
ARO-A11036
Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.
There are no reviews yet.