Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348)

181.00

100ug + 181 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348)

Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348)

Product name Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348)
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity General
Reference ARO-A14956
Isotype IgG2b
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Twin-Strep-tag, Twin Strep tag, TwinStrep tag,Streptag,Strep tag
Target species Anti-General Monoclonal Antibody

There are no reviews yet.

Be the first to review “Anti-Twin-Strep-tag(SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK) Antibody (SAA0348)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products