Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-PHLPXI Antibody (SAA0733)

Original price was: €504.00.Current price is: €388.00.

100ug 23% OFF + 388 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-PHLPXI Antibody (SAA0733)
Anti-PHLPXI Antibody (SAA0733)

Anti-PHLPXI Antibody (SAA0733)

Product name ARO-A14727-100
Uniprot ID Q8H6L7
Raw Antigen Sequence DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKECGGILQAYDLRDAPETP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14727
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen PHLPXI, Pollen allergen Phl p 11, Allergen Phl p XI
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A14727-1MG
Uniprot ID Q8H6L7
Raw Antigen Sequence DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKECGGILQAYDLRDAPETP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14727
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen PHLPXI, Pollen allergen Phl p 11, Allergen Phl p XI
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody
Product name ARO-A14727-50
Uniprot ID Q8H6L7
Raw Antigen Sequence DKGPGFVVTGRVYCDPCRAGFETNVSHNVQGATVAVDCRPFNGGESKLKAEATTDGLGWYKIEIDQDHQEEICEVVLAKSPDTTCSEIEEFRDRARVPLTSNNGIKQQGIRYANPIAFFRKEPLKECGGILQAYDLRDAPETP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Reactivity Phleum pratense (Common timothy)
Reference ARO-A14727
Isotype IgG1
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen PHLPXI, Pollen allergen Phl p 11, Allergen Phl p XI
Target species Anti-Phleum pratense (Common timothy) Monoclonal Antibody

SDS-PAGE for Anti-PHLPXI Antibody (SAA0733)

SDS-PAGE for Anti-PHLPXI Antibody (SAA0733)

Anti-PHLPXI Antibody (SAA0733), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-PHLPXI Antibody (SAA0733)

There are no reviews yet.

Be the first to review “Anti-PHLPXI Antibody (SAA0733)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products