Anti-ORF7a protein polyclonal antibody

Reference: PTXCOV-A559
Size

100ug

Brand

Product type

Host Species

Clonality

Applications

Description of Anti-ORF7a protein polyclonal antibody

Product nameAnti-ORF7a protein polyclonal antibody
SourceP0DTC7
SpeciesSARS-CoV-2
Molecular weight13kDa
BufferPBS, pH7.4, containing 0.05% proclin300, 50% glycerol
FormLiquid
Delivery conditionBlue ice (+4°)
Storage condition4°C for short term; -20°c or -80°C for long term
BrandProteogenix
Host speciesRabbit
ApplicationsELISA
Aliases – SynonymsORF7a protein
Size100ug
ReferencePTXCOV-A559
NoteFor research use and in vitro diagnostic only. Not suitable for human use.
IsotypeIgG
ClonalityPolyclonal Antibody
TargetORF7a: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
SourceP0DTC7

Reviews

There are no reviews yet.

Be the first to review “Anti-ORF7a protein polyclonal antibody”

Your email address will not be published.


330.00

OK

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us to order

+33 (0)3 90 20 54 70

Write us

Categories: