Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-ACE2 polyclonal antibody

  • PTXCOV-A531-50
  • Validated WB
Note:
For research use and in vitro diagnostic only. Not suitable for human use.

Original price was: €156.00.Current price is: €118.00.

50ug 24% OFF + 118 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-ACE2 polyclonal antibody binds to Recombinant Human ACE2 Protein, HRP in WB Assay
Anti-ACE2 polyclonal antibody

Anti-ACE2 polyclonal antibody

Product name PTXCOV-A531-100
Uniprot ID Q9BYF1
Source Q9BYF1
Species Human
Raw Antigen Sequence LLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
Molecular weight 92kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Angiotensin-converting enzyme 2
Size 100ug
Reference PTXCOV-A531
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant Human ACE-2 protein(Leu392-Ser740)
Product name PTXCOV-A531-1MG
Uniprot ID Q9BYF1
Source Q9BYF1
Species Human
Raw Antigen Sequence LLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
Molecular weight 92kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Angiotensin-converting enzyme 2
Size 100ug
Reference PTXCOV-A531
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant Human ACE-2 protein(Leu392-Ser740)
Product name PTXCOV-A531-50
Uniprot ID Q9BYF1
Source Q9BYF1
Species Human
Raw Antigen Sequence LLRNGANEGFHEAVGEIMSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLGPPNQPPVS
Molecular weight 92kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms Angiotensin-converting enzyme 2
Size 100ug
Reference PTXCOV-A531
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant Human ACE-2 protein(Leu392-Ser740)

Anti-ACE2 polyclonal antibody binds to Recombinant Human ACE2 Protein, HRP in WB Assay

Anti-ACE2 polyclonal antibody binds to Recombinant Human ACE2 Protein, HRP in WB Assay

Recombinant Human ACE2 Protein, HRP(cat. No.ARO-P16932) can bind Anti-ACE2 polyclonal antibody in Western Blot Assay as detected on gel analysis.

Anti-ACE2 polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-ACE2 polyclonal antibody”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products