Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Ncov-E polyclonal antibody

Note:
For research use and in vitro diagnostic only. Not suitable for human use.

Original price was: €159.00.Current price is: €118.00.

50ug 26% OFF + 118 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Ncov-E polyclonal antibody

Anti-Ncov-E polyclonal antibody

Product name PTXCOV-A563-100
Uniprot ID P0DTC4
Source P0DTC4
Species SARS-CoV-2
Raw Antigen Sequence MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Molecular weight 8kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms 2019-nCoV E protein
Size 100ug
Reference PTXCOV-A563
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant SARS-CoV-2 E protein(Met1-Val75)
Product name PTXCOV-A563-1MG
Uniprot ID P0DTC4
Source P0DTC4
Species SARS-CoV-2
Raw Antigen Sequence MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Molecular weight 8kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms 2019-nCoV E protein
Size 100ug
Reference PTXCOV-A563
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant SARS-CoV-2 E protein(Met1-Val75)
Product name PTXCOV-A563-50
Uniprot ID P0DTC4
Source P0DTC4
Species SARS-CoV-2
Raw Antigen Sequence MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
Molecular weight 8kDa
Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol
Form Liquid
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term; -20°c or -80°C for long term
Brand Proteogenix
Host species Rabbit
Aliases – Synonyms 2019-nCoV E protein
Size 100ug
Reference PTXCOV-A563
Note For research use and in vitro diagnostic only. Not suitable for human use.
Isotype IgG
Clonality Polyclonal Antibody
Target Recombinant SARS-CoV-2 E protein(Met1-Val75)

Anti-Ncov-E polyclonal antibody

There are no reviews yet.

Be the first to review “Anti-Ncov-E polyclonal antibody”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products