Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Original price was: €536.00.Current price is: €391.00.

100ug 27% OFF + 391 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Product name ARO-A15618-100
Uniprot ID P35461
Raw Antigen Sequence MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15618
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Ly6g/Ly-6G.1
Clone Name 1A8
Protein Name Ly6g/Ly-6G.1
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15618-1MG
Uniprot ID P35461
Raw Antigen Sequence MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15618
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Ly6g/Ly-6G.1
Clone Name 1A8
Protein Name Ly6g/Ly-6G.1
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15618-50
Uniprot ID P35461
Raw Antigen Sequence MDTCHIAKSCVLILLVVLLCAERAQGLECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNAAVPTGGSSWTMAGVLLFSLVSVLLQTFL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15618
Isotype IgG2a, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen Ly6g/Ly-6G.1
Clone Name 1A8
Protein Name Ly6g/Ly-6G.1
Target species Anti-Mouse Monoclonal Antibody

SDS-PAGE for Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

SDS-PAGE for Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)

There are no reviews yet.

Be the first to review “Anti-Mouse Ly6g/Ly-6G.1 Antibody (1A8)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products