Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Mouse HMGB1 Antibody (DPH1.1)

  • ARO-A15083-50
  • Validated WB

Original price was: €337.00.Current price is: €272.00.

50ug 19% OFF + 272 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Mouse HMGB1 Antibody (DPH1.1)
Anti-Mouse HMGB1 Antibody (DPH1.1) binds to Mouse HMGB1 Protein, N-His, recombinant protein in WB Assay
Anti-Mouse HMGB1 Antibody (DPH1.1)

Anti-Mouse HMGB1 Antibody (DPH1.1)

Product name ARO-A15083-100
Uniprot ID P63158
Raw Antigen Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rat
Reactivity Mouse
Reference ARO-A15083
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen High mobility group protein B1, HMGB1, HMG1, HMG-1, High mobility group protein 1
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15083-1MG
Uniprot ID P63158
Raw Antigen Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rat
Reactivity Mouse
Reference ARO-A15083
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen High mobility group protein B1, HMGB1, HMG1, HMG-1, High mobility group protein 1
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15083-50
Uniprot ID P63158
Raw Antigen Sequence MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rat
Reactivity Mouse
Reference ARO-A15083
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen High mobility group protein B1, HMGB1, HMG1, HMG-1, High mobility group protein 1
Target species Anti-Mouse Monoclonal Antibody

SDS-PAGE for Anti-Mouse HMGB1 Antibody (DPH1.1)

SDS-PAGE for Anti-Mouse HMGB1 Antibody (DPH1.1)

Anti-Mouse HMGB1 Antibody (DPH1.1), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Mouse HMGB1 Antibody (DPH1.1) binds to Mouse HMGB1 Protein, N-His, recombinant protein in WB Assay

Anti-Mouse HMGB1 Antibody (DPH1.1) binds to Mouse HMGB1 Protein, N-His, recombinant protein in WB Assay

Mouse HMGB1 Protein, N-His, recombinant protein(cat. No.PX-P5985) can bind Anti-Mouse HMGB1 Antibody (DPH1.1) in Western Blot Assay as detected on gel analysis.

Anti-Mouse HMGB1 Antibody (DPH1.1)

There are no reviews yet.

Be the first to review “Anti-Mouse HMGB1 Antibody (DPH1.1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products