Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Mouse CD3E Antibody (145-2C11)

  • ARO-A15721-50
  • Validated ELISA

Original price was: €340.00.Current price is: €274.00.

50ug 19% OFF + 274 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Mouse CD3E Antibody (145-2C11)

Product name ARO-A15721-100
Uniprot ID P22646
Raw Antigen Sequence MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15721
Isotype IgG
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name 145-2C11
Protein Name CD3E
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15721-1MG
Uniprot ID P22646
Raw Antigen Sequence MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15721
Isotype IgG
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name 145-2C11
Protein Name CD3E
Target species Anti-Mouse Monoclonal Antibody
Product name ARO-A15721-50
Uniprot ID P22646
Raw Antigen Sequence MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Reactivity Mouse
Reference ARO-A15721
Isotype IgG
Clonality Monoclonal Antibody
Purification Protein A or G purified.
Immunogen CD3E
Clone Name 145-2C11
Protein Name CD3E
Target species Anti-Mouse Monoclonal Antibody

SEC-HPLC of Anti-Mouse CD3E Antibody (145-2C11)

SEC-HPLC of Anti-Mouse CD3E Antibody (145-2C11)

Anti-Mouse CD3E Antibody (145-2C11)was analyzed by size exclusion chromatography with UV detection.

Anti-Mouse CD3E Antibody (145-2C11)

There are no reviews yet.

Be the first to review “Anti-Mouse CD3E Antibody (145-2C11)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products