Brand: ProteoGenix

Anti-Human SLC10A1 VHH (SAA1065)

ARO-A16371
Quality Chart

Note:: For research use only. Not suitable for human use.

€380.00

100ug + 380 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human SLC10A1 VHH (SAA1065)

Product name	Anti-Human SLC10A1 VHH (SAA1065)
Uniprot ID	Q14973
Raw Antigen Sequence	MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-Cell growth-inhibiting gene 29 protein, anti-Sodium/taurocholate cotransporting polypeptide, anti-NTCP, anti-SLC10A1, anti-Sodium/bile acid cotransporter, anti-Na(+)/taurocholate transport protein, anti-Solute carrier family 10 member 1, anti-Na(+)/bile acid cotransporter
Reference	ARO-A16371
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	SLC10A1
Clone Name	SAA1065
Target species	Anti-Human Monoclonal Antibody