Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human SLC10A1 VHH (SAA1145)

Note:
For research use only. Not suitable for human use.

380.00

100ug + 380 loyalty points
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human SLC10A1 VHH (SAA1145)

Product name Anti-Human SLC10A1 VHH (SAA1145)
Uniprot ID Q14973
Raw Antigen Sequence MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Cell growth-inhibiting gene 29 protein, anti-Sodium/taurocholate cotransporting polypeptide, anti-NTCP, anti-SLC10A1, anti-Sodium/bile acid cotransporter, anti-Na(+)/taurocholate transport protein, anti-Solute carrier family 10 member 1, anti-Na(+)/bile acid cotransporter
Reference ARO-A16368
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen SLC10A1
Clone Name SAA1145
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human SLC10A1 VHH (SAA1145)

SDS-PAGE for Anti-Human SLC10A1 VHH (SAA1145)

Anti-Human SLC10A1 VHH (SAA1145), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human SLC10A1 VHH (SAA1145)

There are no reviews yet.

Be the first to review “Anti-Human SLC10A1 VHH (SAA1145)”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products