Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human RHOB VHH (SAA0880)

Note:
For research use only. Not suitable for human use.

Original price was: €335.00.Current price is: €266.00.

50ug 21% OFF + 266 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human RHOB VHH (SAA0880)

Product name ARO-A16351-100
Uniprot ID P62745
Raw Antigen Sequence MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-RHOB, anti-h6, anti-Rho cDNA clone 6, anti-ARHB, anti-ARH6, anti-Rho-related GTP-binding protein RhoB
Reference ARO-A16351
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen RHOB
Clone Name SAA0880
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16351-1MG
Uniprot ID P62745
Raw Antigen Sequence MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-RHOB, anti-h6, anti-Rho cDNA clone 6, anti-ARHB, anti-ARH6, anti-Rho-related GTP-binding protein RhoB
Reference ARO-A16351
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen RHOB
Clone Name SAA0880
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16351-50
Uniprot ID P62745
Raw Antigen Sequence MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-RHOB, anti-h6, anti-Rho cDNA clone 6, anti-ARHB, anti-ARH6, anti-Rho-related GTP-binding protein RhoB
Reference ARO-A16351
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen RHOB
Clone Name SAA0880
Target species Anti-Human Monoclonal Antibody

SDS-PAGE for Anti-Human RHOB VHH (SAA0880)

SDS-PAGE for Anti-Human RHOB VHH (SAA0880)

Anti-Human RHOB VHH (SAA0880), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human RHOB VHH (SAA0880)

There are no reviews yet.

Be the first to review “Anti-Human RHOB VHH (SAA0880)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products