Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

  • ARO-A15014-100
  • Validated ELISA WB

Original price was: €532.00.Current price is: €388.00.

100ug 27% OFF + 388 loyalty points
Size
Clear
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)
Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)
Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Product name ARO-A15014-100
Uniprot ID P12272
Raw Antigen Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human, Mouse
Reference ARO-A15014
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone-like protein, PTHrP, PTH-rP, Parathyroid hormone-related protein, PTHrP[107-139], PLP, PTHRP, PTHLH
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15014-1MG
Uniprot ID P12272
Raw Antigen Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human, Mouse
Reference ARO-A15014
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone-like protein, PTHrP, PTH-rP, Parathyroid hormone-related protein, PTHrP[107-139], PLP, PTHRP, PTHLH
Target species Anti-Human, Mouse Monoclonal Antibody
Product name ARO-A15014-50
Uniprot ID P12272
Raw Antigen Sequence MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human, Mouse
Reference ARO-A15014
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone-like protein, PTHrP, PTH-rP, Parathyroid hormone-related protein, PTHrP[107-139], PLP, PTHRP, PTHLH
Target species Anti-Human, Mouse Monoclonal Antibody

SDS-PAGE for Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

SDS-PAGE for Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)

There are no reviews yet.

Be the first to review “Anti-Human PTHrP/PTHLH (1-34) Antibody (SAA0326)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products