Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human PTH(1-34)Antibody (168g2/183k)

  • ARO-A15017-50
  • Validated ELISA WB

Original price was: €378.00.Current price is: €272.00.

50ug 28% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human PTH(1-34)Antibody (168g2/183k)

Product name ARO-A15017-100
Uniprot ID P01270
Raw Antigen Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15017
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone, Parathormone, PTH, Parathyrin
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15017-1MG
Uniprot ID P01270
Raw Antigen Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15017
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone, Parathormone, PTH, Parathyrin
Target species Anti-Human Monoclonal Antibody
Product name ARO-A15017-50
Uniprot ID P01270
Raw Antigen Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reactivity Human
Reference ARO-A15017
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen Parathyroid hormone, Parathormone, PTH, Parathyrin
Target species Anti-Human Monoclonal Antibody

Anti-Human PTH(1-34)Antibody (168g2/183k) in ELISA Assay

Anti-Human PTH(1-34)Antibody (168g2/183k) in ELISA Assay

Anti-Human PTH(1-34)Antibody (168g2/183k) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Anti-Human PTH(1-34)Antibody (168g2/183k) in WB Assay

Anti-Human PTH(1-34)Antibody (168g2/183k) in WB Assay

Anti-Human PTH(1-34)Antibody (168g2/183k) can bind to its target in Western Blot Assay as detected on gel analysis.

Anti-Human PTH(1-34)Antibody (168g2/183k)

There are no reviews yet.

Be the first to review “Anti-Human PTH(1-34)Antibody (168g2/183k)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products