Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Teriparatide Biosimilar – Anti-PTH – Research Grade

Original price was: €182.00.Current price is: €140.00.

50ug 23% OFF + 140 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Teriparatide Biosimilar - Anti-PTH - Research Grade

Product name PX-TA2297-100
Uniprot ID P01270
Raw Antigen Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-PTH, CAS: 52232-67-4
Isotype Biosynthetic Parathyroid hormone (PTH) analogs.
Clonality Polyclonal Antibody
Purification >95% as determined by HPLC.
Protein Name PTH
Product name PX-TA2297-1MG
Uniprot ID P01270
Raw Antigen Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-PTH, CAS: 52232-67-4
Isotype Biosynthetic Parathyroid hormone (PTH) analogs.
Clonality Polyclonal Antibody
Purification >95% as determined by HPLC.
Protein Name PTH
Product name PX-TA2297-50
Uniprot ID P01270
Raw Antigen Sequence MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Human
Aliases /Synonyms Anti-PTH, CAS: 52232-67-4
Isotype Biosynthetic Parathyroid hormone (PTH) analogs.
Clonality Polyclonal Antibody
Purification >95% as determined by HPLC.
Protein Name PTH

Introduction

Teriparatide Biosimilar, also known as Anti-PTH, is a research grade antibody that has been developed to target the parathyroid hormone (PTH) and its receptor. This biosimilar is a promising therapeutic option for the treatment of osteoporosis, a condition characterized by low bone mass and increased risk of fractures. In this article, we will provide a detailed description of the structure, activity and potential applications of Teriparatide Biosimilar.

Structure of Teriparatide Biosimilar

Teriparatide Biosimilar is a monoclonal antibody that is produced through recombinant DNA technology. It is a fully humanized antibody, meaning that it is derived from human cells and has a high affinity for its target. The antibody has a molecular weight of approximately 150 kDa and is composed of two identical heavy chains and two identical light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains have two constant domains (CL) and one variable domain (VL). The variable domains of the antibody are responsible for binding to the PTH receptor and initiating its biological activity.

Activity of Teriparatide Biosimilar

Teriparatide Biosimilar works by binding to the PTH receptor, which is located on the surface of bone cells called osteoblasts. This binding activates a signaling pathway that leads to an increase in the production of new bone tissue and a decrease in bone resorption. This results in an overall increase in bone density and strength, making it an effective treatment for osteoporosis. Additionally, Teriparatide Biosimilar has been shown to stimulate the production of osteoblasts and inhibit the formation of osteoclasts, further promoting bone growth and maintenance.

Therapeutic Target

The therapeutic target of Teriparatide Biosimilar is the PTH receptor, which is a G-protein coupled receptor (GPCR) that is expressed on the surface of osteoblasts. The PTH receptor is activated by the parathyroid hormone, which is responsible for regulating calcium and phosphate levels in the body. In individuals with osteoporosis, the PTH receptor is overactive, leading to increased bone resorption and decreased bone formation. By targeting the PTH receptor, Teriparatide Biosimilar can restore the balance between bone resorption and formation, ultimately improving bone health.

Application of Teriparatide Biosimilar

Teriparatide Biosimilar has been primarily developed for the treatment of osteoporosis. It has been shown to significantly increase bone mineral density and reduce the risk of fractures in individuals with the condition. Additionally, Teriparatide Biosimilar has been investigated for its potential use in other bone-related disorders, such as osteogenesis imperfecta and bone metastases. It has also shown promising results in preclinical studies for the treatment of rheumatoid arthritis and bone loss associated with aging.

Conclusion

In summary, Teriparatide Biosimilar is a research grade antibody that specifically targets the PTH receptor and has shown promising results for the treatment of osteoporosis. Its unique structure and mechanism of action make it a potential therapeutic option for other bone-related disorders as well. Further research and clinical trials are needed to fully understand the potential of this biosimilar in the field of bone health.

There are no reviews yet.

Be the first to review “Teriparatide Biosimilar – Anti-PTH – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products