Brand: ProteoGenix

Anti-Human PSA/KLK3 Antibody (SAA0506), PE

ARO-A10577-50
Quality Chart

Clonality:: Monoclonal Antibody
Host species:: Human
Isotype:: IgG1
Target species:: Human
Clone Name:: SAA0506

Original price was: €425.00.Current price is: €354.00.

50ug 17% OFF + 354 loyalty points

Size Size

50ug Original price was: €425.00.Current price is: €354.00.
100ug Original price was: €631.00.Current price is: €505.00.
1MG Original price was: €1,846.00.Current price is: €1,465.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

Datasheet

Anti-Human PSA/KLK3 Antibody (SAA0506), PE

Product name	ARO-A10577-100
Uniprot ID	P07288
Raw Antigen Sequence	MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Prostate-specific antigen, KLK3, Kallikrein-3, APS, Semenogelase, PSA, Gamma-seminoprotein, Seminin, P-30 antigen
Reference	ARO-A10577
Note	For research use only.
Isotype	IgG1
Clonality	Monoclonal Antibody
Target	Prostate-specific antigen, KLK3, Kallikrein-3, APS, Semenogelase, PSA, Gamma-seminoprotein, Seminin, P-30 antigen
Clone Name	SAA0506
Target species	Human

Product name	ARO-A10577-1MG
Uniprot ID	P07288
Raw Antigen Sequence	MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Prostate-specific antigen, KLK3, Kallikrein-3, APS, Semenogelase, PSA, Gamma-seminoprotein, Seminin, P-30 antigen
Reference	ARO-A10577
Note	For research use only.
Isotype	IgG1
Clonality	Monoclonal Antibody
Target	Prostate-specific antigen, KLK3, Kallikrein-3, APS, Semenogelase, PSA, Gamma-seminoprotein, Seminin, P-30 antigen
Clone Name	SAA0506
Target species	Human

Product name	ARO-A10577-50
Uniprot ID	P07288
Raw Antigen Sequence	MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
Buffer	0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300.
Delivery condition	Blue ice (+4°C)
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand	ProteoGenix
Host species	Human
Aliases /Synonyms	Anti-Prostate-specific antigen, KLK3, Kallikrein-3, APS, Semenogelase, PSA, Gamma-seminoprotein, Seminin, P-30 antigen
Reference	ARO-A10577
Note	For research use only.
Isotype	IgG1
Clonality	Monoclonal Antibody
Target	Prostate-specific antigen, KLK3, Kallikrein-3, APS, Semenogelase, PSA, Gamma-seminoprotein, Seminin, P-30 antigen
Clone Name	SAA0506
Target species	Human