Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US ($)

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Human MMP14 Antibody (LEM-2/15)

  • ARO-A15087-50
  • Validated ELISA FC WB

Original price was: €367.00.Current price is: €272.00.

50ug 26% OFF + 272 loyalty points
Size
  • In Stock
  • Free shipping in EU on orders > €500
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Human MMP14 Antibody (LEM-2/15)

Product name ARO-A15087-100
Uniprot ID P50281
Raw Antigen Sequence MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reference ARO-A15087
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen MT-MMP 1, Matrix metalloproteinase-14, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase, MMP14, MTMMP1, MT1-MMP, MMP-14, MMP-X1, MT1MMP
Target species Anti- Monoclonal Antibody
Product name ARO-A15087-1MG
Uniprot ID P50281
Raw Antigen Sequence MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reference ARO-A15087
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen MT-MMP 1, Matrix metalloproteinase-14, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase, MMP14, MTMMP1, MT1-MMP, MMP-14, MMP-X1, MT1MMP
Target species Anti- Monoclonal Antibody
Product name ARO-A15087-50
Uniprot ID P50281
Raw Antigen Sequence MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Mouse
Reference ARO-A15087
Isotype IgG1, kappa
Clonality Monoclonal Antibody
Purification Protein A or G purified from cell culture supernatant.
Immunogen MT-MMP 1, Matrix metalloproteinase-14, Membrane-type matrix metalloproteinase 1, Membrane-type-1 matrix metalloproteinase, MMP14, MTMMP1, MT1-MMP, MMP-14, MMP-X1, MT1MMP
Target species Anti- Monoclonal Antibody

Flow Cytometry results for Anti-Human MMP14 Antibody (LEM-2/15)

Flow Cytometry results for Anti-Human MMP14 Antibody (LEM-2/15)

Flow-cytometry using anti-human MMP14 antibody.MDA-MB-231 cells were stained with an irrelevant antibody (Blue Histogram) or an anti-human MMP14 antibody monoclonal antibody (Catalog # ARO-A15087 ,Green Histogram) at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using a FITC conjugated goat anti-mouse antibody (Catalog # PTX17818) and cells analysed on a NovoCyte Flow Cytometer.

SDS-PAGE for Anti-Human MMP14 Antibody (LEM-2/15)

SDS-PAGE for Anti-Human MMP14 Antibody (LEM-2/15)

Anti-Human MMP14 Antibody (LEM-2/15), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human MMP14 Antibody (LEM-2/15)

There are no reviews yet.

Be the first to review “Anti-Human MMP14 Antibody (LEM-2/15)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products