Brand: ProteoGenix

Anti-Human LRP5/6 Antibody (SAA0791)

ARO-A14691-100
Quality Chart

Original price was: €532.00.Current price is: €388.00.

100ug 27% OFF + 388 loyalty points

Size Size

50ug Original price was: €340.00.Current price is: €272.00.
100ug Original price was: €532.00.Current price is: €388.00.
1MG Original price was: €1,451.00.Current price is: €1,125.00.

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Free shipping in EU on orders > €500
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Human LRP5/6 Antibody (SAA0791)

Datasheet

Anti-Human LRP5/6 Antibody (SAA0791)

Product name	ARO-A14691-100
Uniprot ID	O75197, O75581
Raw Antigen Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Reference	ARO-A14691
Isotype	IgG2a
Clonality	Monoclonal Antibody
Purification	Protein A or G purified from cell culture supernatant.
Immunogen	LRP5, L3, LRP7, Low-density lipoprotein receptor-related protein 5, LRP-5, Low-density lipoprotein receptor-related protein 7, LRP-7, LRP6, Low-density lipoprotein receptor-related protein 6, LRP-6
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A14691-1MG
Uniprot ID	O75197, O75581
Raw Antigen Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Reference	ARO-A14691
Isotype	IgG2a
Clonality	Monoclonal Antibody
Purification	Protein A or G purified from cell culture supernatant.
Immunogen	LRP5, L3, LRP7, Low-density lipoprotein receptor-related protein 5, LRP-5, Low-density lipoprotein receptor-related protein 7, LRP-7, LRP6, Low-density lipoprotein receptor-related protein 6, LRP-6
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A14691-50
Uniprot ID	O75197, O75581
Raw Antigen Sequence	MQLPLALCLVCLLVHTAFRVVEGQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	Mouse
Reactivity	Human
Reference	ARO-A14691
Isotype	IgG2a
Clonality	Monoclonal Antibody
Purification	Protein A or G purified from cell culture supernatant.
Immunogen	LRP5, L3, LRP7, Low-density lipoprotein receptor-related protein 5, LRP-5, Low-density lipoprotein receptor-related protein 7, LRP-7, LRP6, Low-density lipoprotein receptor-related protein 6, LRP-6
Target species	Anti-Human Monoclonal Antibody